other food products-Global FoodMate

| Make foodmate.com your Homepage | Wap | Archiver

Advanced Top

Current Position: Home » Selling Leads » Others

Browse by categories

Alcohol & Wine (32074)	Bakery Foods (222)	Baby Foods (140)	Bean Products (304)	Beverages (1209)
Canned Food (482)	Cigarettes & Tobacco (95)	Confectionaries (276)	Fats & Oils (566)	Egg Products (56)
Food Additives (1564)	Food Ingredients (1532)	Food Packaging (780)	Food Tech. Services (58)	Food Processing Machine (2943)
Frozen Foods (880)	Fruit (737)	Gums & Stabilizers (28)	Honey Products (101)	Health & Functional Food (1097)
Instant Foods (140)	Meat & Poultry (195)	Milk & Dairy Product (229)	Mushrooms (113)	Native Products (40)
Noodles & Pasta (101)	Nuts & Kernels (371)	Pet Foods (110)	Rice & Grains (358)	Seafood (1357)
Snack Foods (326)	Spice & Seasoning (733)	Starch & Flour (144)	Sugar & Sweetener (140)	Tea (315)
Vegetables (836)	Lab Instruments (478)	Others (3885)

all supply service used provide processing cooperation stock

list price image VIP

Triptorelin, 2mg/vial
Triptorelin, 2mg/vialProduct Name: Triptorelin Synonyms: PGLU-HIS-TRP-SER-TYR-D-TRP-LEU-ARG-PRO-GLY-NH2;PYROGLU-HIS-TRP-SER-TYR-D-TRP-LEU-ARG-PRO-GLY NH2;PYR-HIS-TRP-SER-TYR-D-TRP-LEU-ARG-PRO-GLY-NH2
Jun 05, 2015 FOB Price: 1.00usd/G Min. Order: 10 G
[China] Zhuhaishi Shuangbojie Technology Co,. Ltd [Unverified]

HGH 176-191, 2mg/vial
HGH 176-191, 2mg/vialMolucular Formula: C78H123N23O23S2 Molecular weight: 1815.08 Peptide purity: 98.0% Appearance: White powder Related substance: Total Impurities(%) 2.0% Acetate content:
Jun 05, 2015 FOB Price: 1.00usd/G Min. Order: 10 G
[China] Zhuhaishi Shuangbojie Technology Co,. Ltd [Unverified]

TB-500, 2mg/vial
TB-500, 2mg/vialThymosin 4 Acetate (TB-500) Standard Size 200 g Sequence Ac - Ser - Asp - Lys - Pro - Asp - Met - Ala - Glu - Ile - Glu - Lys - Phe - Asp - Lys - Ser - Lys - Leu - Lys - Lys - Thr -
Jun 05, 2015 FOB Price: 1.00usd/G Min. Order: 10 G
[China] Zhuhaishi Shuangbojie Technology Co,. Ltd [Unverified]

Sermorelin, 2mg/vial
Sermorelin, 2mg/vialProduct Name: Sermorelin Synonyms: SERMORELIN;SERMORELIN ACETATE;YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2;TYR-ALA-ASP-ALA-ILE-PHE-THR-ASN-SER-TYR-ARG-LYS-VAL-LEU-GLY-GLN-LEU-SER-ALA-ARG-
Jun 05, 2015 FOB Price: 1.00usd/G Min. Order: 10 G
[China] Zhuhaishi Shuangbojie Technology Co,. Ltd [Unverified]

Ipamorelin, 2mg/vial
Ipamorelin, 2mg/vialCAS No.: 170851-70-4 Other Names: Ipamorelin MF: C38H49N9O5 Place of Origin: Zhejiang China (Mainland) Type: Pharmaceutical Intermediates Purity: 99% Molecular Weight 711.86P
Jun 05, 2015 FOB Price: 1.00usd/G Min. Order: 10 G
[China] Zhuhaishi Shuangbojie Technology Co,. Ltd [Unverified]

GHRP-2, 5mg/vial, 10mg/vial
GHRP-2, 5mg/vial, 10mg/vialProduct Name: Pralmorelin Synonyms: PRALMORELIN;D-ALA-D-NAL(2)-ALA-TRP-D-PHE-LYS-NH2 ACETATE SALT;D-ALA-BETA-(2-NAPHTHYL)-D-ALA-TRP-D-PHE-LYS AMIDE;D-ALA-D-2-NAL-ALA-TRP-D-
Jun 05, 2015 FOB Price: 1.00usd/G Min. Order: 10 G
[China] Zhuhaishi Shuangbojie Technology Co,. Ltd [Unverified]

Melanotan-2, 10mg/vial
Melanotan-2, 10mg/vialProduct Name: Melanotan II Synonyms: AC-NLE-CYCLO(-BETA-ASP-HIS-D-PHE-ARG-TRP-EPSILON-LYS-NH2);AC-NLE-CYCLO[(BETA-D)-HFRW-(EPSILON-K)]-NH2;AC-NLE-CYCLO(-ASP-HIS-D-PHE-ARG-TRP-LY
Jun 05, 2015 FOB Price: 1.00usd/G Min. Order: 10 G
[China] Zhuhaishi Shuangbojie Technology Co,. Ltd [Unverified]

Melanotan-1, 10mg/vial
Melanotan-1, 10mg/vialProduct Name: Melanotan-1 Synonyms: [NLE4,D-PHE]ALPHA-MELANOCYTE STIMULATING HORMONE;(NLE4,D-PHE7)-ALPHA-MSH;[NLE4, D-PHE7]-ALPHA-MSH, AMIDE;[NLE4,D-PHE7]-ALPHA-MELANOCYTE-STIMU
Jun 05, 2015 FOB Price: 1.00usd/G Min. Order: 10 G
[China] Zhuhaishi Shuangbojie Technology Co,. Ltd [Unverified]

PT-141,Bremelanotide, 10mg/vial
PT-141,Bremelanotide, 10mg/vialMolecular Formula: C50H68N14O10 Molecular Weight: 1025.16 CAS NO:189691-06-3 Sequence:H-D-Ala-D-2-Nal-Ala-Trp-D-Phe-Lys-NH2 1.Appearance White powder White powder 2 Solu
Jun 05, 2015 FOB Price: 1.00usd/G Min. Order: 10 G
[China] Zhuhaishi Shuangbojie Technology Co,. Ltd [Unverified]

CJC-1295 no DAC, 2mg/vial
CJC-1295 no DAC, 2mg/vialMolecular Formula:C165H269N47O46 Molecular Weight:3647.15 CAS No.:863288-34-0 Specification:2mg*10vials/kit Sequence: Tyr-D-Ala-Asp-Ala-Ile-Phe-Thr-Gln-Ser-Tyr-Arg-Lys-Val-L
Jun 05, 2015 FOB Price: 1.00usd/G Min. Order: 10 G
[China] Zhuhaishi Shuangbojie Technology Co,. Ltd [Unverified]

CJC-1295 with DAC, 2mg/vial
CJC-1295 with DAC, 2mg/vialCas No. 863288-34-0 CJC 1295 DAC, a long acting GHRH polypeptide, causes the anterior pituitary s somatotropes to release growth hormone. DAC conjugated CJC 1295, makes this
Jun 05, 2015 FOB Price: 1.00usd/G Min. Order: 10 G
[China] Zhuhaishi Shuangbojie Technology Co,. Ltd [Unverified]

PEG MGF, 2mg/vial
PEG MGF, 2mg/vialFunction: Promotion Development Dosage Form: Powder PEG-MGF Sequence: PEG-Suc-Tyr-Gln-Pro-Pro-Ser-Thr-Asn-Thr-Lys-Ser-Gln-D-Arg-Lys-Gly-Ser-Thr-Phe-Glu-Glu-His-Lys-NH2 Active Substan
Jun 05, 2015 FOB Price: 1.00usd/G Min. Order: 10 G
[China] Zhuhaishi Shuangbojie Technology Co,. Ltd [Unverified]

MGF, 2mg/vial
MGF, 2mg/vialSequence: Tyr - Gln - Pro - Pro - Ser - Thr - Asn - Lys - Asn - Thr - Lys - Ser - Gln - D - Arg - D - Arg - Lys - Gly - Ser - Thr - Phe - Glu - Glu - His - Lys - NH2 M.W: 2848.13 Solubili
Jun 04, 2015 FOB Price: 1.00usd/G Min. Order: 10 G
[China] Zhuhaishi Shuangbojie Technology Co,. Ltd [Unverified]

Grape-skin red
Product Name: Grape-Skin Red it is a kind of natural edible pigment extracted from grape skin. the main composition is anthocyanins including oenins, syringidins. the dark purple powder color is solu
Nov 02, 2018 FOB Price: Get Latest Price Min. Order: negotiable
[China] Whyuanchength [Unverified]

Mesterolone Proviron
Mesterolone Proviron Steroidscx05 (at) yccreate (dot )com skype: annaaqqhigh-quality steroids powders for sale Here at Hubei Yuancheng Saichuang Technology Co.Ltd .we are one of the worlds leadin
May 29, 2015 FOB Price: 15.00usd/g Min. Order: 10 g
[China] Hubei Hongxin Group [Unverified]

Turinabol
Turinabol oralcx05 (at) yccreate (dot )com skype: annaaqq high-quality steroids powders for sale Here at Hubei Yuancheng Saichuang Technology Co.Ltd .we are one of the worlds leading manufactures
May 29, 2015 FOB Price: 15.00usd/g Min. Order: 10 g
[China] Hubei Hongxin Group [Unverified]

Anastrozole120511-73-1
Anastrozole Structural formula: C17H19N5 Molecular weight: 29337 CAS NO: 120511-73-1 Appearance: an off-white color crystalline powder Use: It can be used to the treatment of Breast cancer Standard: E
May 27, 2015 FOB Price: Get Latest Price Min. Order: negotiable
[China] Hubei Yuancheng saichuang Technology Co. Ltd. [Unverified]

Stanozolol(winstrol)10148-03-8
Stanozolol(winstrol) Chemical Name:5alpha-androstan-17alpha methyl-17beta ol-[3,2-c] pyrazole Molecular Formula: C21H32N2O Molecular weight: 328.49 CAS NO.: 10148-03-8 Standard: USP28/BP2003
May 27, 2015 FOB Price: Get Latest Price Min. Order: negotiable
[China] Hubei Yuancheng saichuang Technology Co. Ltd. [Unverified]

Oxandrolone53-39-4
Oxandrolone Chemical Name: 5alpha-androstan-2-oxa-17alpha-methyl-17beta-ol-3-one Molecular Formula: C19H30O3 Molecular weight: 306.4 CAS NO.: 53-39-4 Appearance: White or almost white crystalline powd
May 27, 2015 FOB Price: Get Latest Price Min. Order: negotiable
[China] Hubei Yuancheng saichuang Technology Co. Ltd. [Unverified]

Oxymetholone 434-07-1
Oxymetholone Chemical Name: 5 -androstan-2-hydroxymethylene-17alpha-methyl-17beta-ol-3-one Molecular Formula: C21H32O3 Molecular weight: 332.48 CAS NO.: 434-07-1 Standard: USP28/BP2003
May 27, 2015 FOB Price: Get Latest Price Min. Order: negotiable
[China] Hubei Yuancheng saichuang Technology Co. Ltd. [Unverified]

Previous Page: 1 2 … 161 162 163 164 165 … 194 195 Next 3885 items in all Page

Top search week

63 resultsyam
1375 resultsGü
2921 resultsAdditive
2122 resultsseafood
4024 resultsFoods
1632 resultsFruit
81 resultsbanana
115 resultscheese
146 resultsENSO
38009 resultswine

Browse by countries

China	USA
UK	Japan
Germany	Netherlands
S.Korea	Canada
Australia	India
Russia	France
Spain	Italy
Switzerland	Vietnam
Brazil	New Zealand
Singapore	Finland
Portugal	Poland
Indonesia	Chile
More Countries

鲁公网安备 37060202000792号

Processed in 0.826 second(s), 108 queries, Memory 3.49 M

Message Center(0)

Member Service | Post Info | Business Center | Back To Homepage